C21ORF91 antibody (70R-3330)

Rabbit polyclonal C21ORF91 antibody raised against the middle region of C21Orf91

Synonyms Polyclonal C21ORF91 antibody, Anti-C21ORF91 antibody, Chromosome ORF-21 antibody, Chromosome ORF 21 antibody, Chromosome ORF 21, Chromosome ORF-21, C21orf14 antibody, Chromosome 21 ORF, DKFZp781D1223 antibody, C21orf38 antibody, YG81 antibody
Specificity C21ORF91 antibody was raised against the middle region of C21Orf91
Cross Reactivity Human
Applications WB
Immunogen C21ORF91 antibody was raised using the middle region of C21Orf91 corresponding to a region with amino acids LCRNSVLWPHSHNQAQKKEETISSPEANVQTQHPHYSREELNSMTLGEVE
Assay Information C21ORF91 Blocking Peptide, catalog no. 33R-4830, is also available for use as a blocking control in assays to test for specificity of this C21ORF91 antibody


Western Blot analysis using C21ORF91 antibody (70R-3330)

C21ORF91 antibody (70R-3330) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C21ORF91 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C21orf91 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C21ORF91 antibody (70R-3330) | C21ORF91 antibody (70R-3330) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors