C22ORF28 antibody (70R-4338)

Rabbit polyclonal C22ORF28 antibody raised against the N terminal Of C22Orf28

Synonyms Polyclonal C22ORF28 antibody, Anti-C22ORF28 antibody, Chromosome ORF 22, RP1-149A16.6 antibody, Chromosome ORF-22, Chromosome ORF 22 antibody, DJ149A16.6 antibody, Chromosome 22 ORF, HSPC117 antibody, Chromosome ORF-22 antibody
Specificity C22ORF28 antibody was raised against the N terminal Of C22Orf28
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen C22ORF28 antibody was raised using the N terminal Of C22Orf28 corresponding to a region with amino acids PEAVVSPGGVGFDINCGVRLLRTNLDESDVQPVKEQLAQAMFDHIPVGVG
Assay Information C22ORF28 Blocking Peptide, catalog no. 33R-7033, is also available for use as a blocking control in assays to test for specificity of this C22ORF28 antibody

Images

Western Blot analysis using C22ORF28 antibody (70R-4338)

C22ORF28 antibody (70R-4338) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C22ORF28 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C22ORF28 is believed to be involved in vinculin binding.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C22ORF28 antibody (70R-4338) | C22ORF28 antibody (70R-4338) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors