C2ORF18 antibody (70R-7420)

Rabbit polyclonal C2ORF18 antibody raised against the middle region of C2Orf18

Synonyms Polyclonal C2ORF18 antibody, Anti-C2ORF18 antibody, Chromosome ORF 2 antibody, Chromosome 2 ORF, FLJ20555 antibody, Chromosome ORF-2, Chromosome ORF-2 antibody, Chromosome ORF 2
Specificity C2ORF18 antibody was raised against the middle region of C2Orf18
Cross Reactivity Human
Applications WB
Immunogen C2ORF18 antibody was raised using the middle region of C2Orf18 corresponding to a region with amino acids GLFGFVILSLLLVPMYYIPAGSFSGNPRGTLEDALDAFCQVGQQPLIAVA
Assay Information C2ORF18 Blocking Peptide, catalog no. 33R-3391, is also available for use as a blocking control in assays to test for specificity of this C2ORF18 antibody


Western Blot analysis using C2ORF18 antibody (70R-7420)

C2ORF18 antibody (70R-7420) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2ORF18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C2orf18 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C2ORF18 antibody (70R-7420) | C2ORF18 antibody (70R-7420) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors