C2orf25 antibody (70R-4055)

Rabbit polyclonal C2orf25 antibody

Synonyms Polyclonal C2orf25 antibody, Anti-C2orf25 antibody, CL25022 antibody, Cobalamin Deficiency Cbld Type With Homocystinuria antibody, Chromosome ORF 2 antibody, Chromosome ORF 2, Chromosome ORF-2, Methylmalonic Aciduria antibody, Chromosome 2 ORF, Chromosome ORF-2 antibody
Cross Reactivity Human
Applications WB
Immunogen C2orf25 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSSGSDESHVAAAPPDICSRTVWPDETMGPFGPQDQRFQLPGNIGFDCHL
Assay Information C2orf25 Blocking Peptide, catalog no. 33R-3586, is also available for use as a blocking control in assays to test for specificity of this C2orf25 antibody

Images

Western Blot analysis using C2orf25 antibody (70R-4055)

C2orf25 antibody (70R-4055) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2orf25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Vitamin B12 (cobalamin) is an essential cofactor in several metabolic pathways. Intracellular conversion of cobalamin to adenosylcobalamin in mitochondria and to methylcobalamin in cytoplasm is necessary for homeostasis of methylmalonic acid and homocysteine. C2ORF25 encodes a protein involved in an early step of cobalamin metabolism.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C2orf25 antibody (70R-4055) | C2orf25 antibody (70R-4055) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors