C2ORF29 antibody (70R-3470)

Rabbit polyclonal C2ORF29 antibody raised against the middle region of C2Orf29

Synonyms Polyclonal C2ORF29 antibody, Anti-C2ORF29 antibody, Chromosome ORF-2 antibody, Chromosome ORF 2, Chromosome ORF-2, Chromosome 2 ORF, C40 antibody, Chromosome ORF 2 antibody
Specificity C2ORF29 antibody was raised against the middle region of C2Orf29
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen C2ORF29 antibody was raised using the middle region of C2Orf29 corresponding to a region with amino acids SVDISGLQLALAERQSELPTQSKASFPSILSDPDPDSSNSGFDSSVASQI
Assay Information C2ORF29 Blocking Peptide, catalog no. 33R-8905, is also available for use as a blocking control in assays to test for specificity of this C2ORF29 antibody

Images

Western Blot analysis using C2ORF29 antibody (70R-3470)

C2ORF29 antibody (70R-3470) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2ORF29 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C2ORF29 antibody (70R-3470) | C2ORF29 antibody (70R-3470) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors