C2orf30 antibody (70R-4009)

Rabbit polyclonal C2orf30 antibody raised against the middle region of C2orf30

Synonyms Polyclonal C2orf30 antibody, Anti-C2orf30 antibody, CL24936 antibody, XTP3TPB antibody, Chromosome ORF 2 antibody, Chromosome ORF-2, Chromosome ORF-2 antibody, Endoplasmic Reticulum Lectin 1 antibody, CL25084 antibody, Chromosome ORF 2, Chromosome 2 ORF
Specificity C2orf30 antibody was raised against the middle region of C2orf30
Cross Reactivity Human
Applications WB
Immunogen C2orf30 antibody was raised using the middle region of C2orf30 corresponding to a region with amino acids GKHVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTV
Assay Information C2orf30 Blocking Peptide, catalog no. 33R-3363, is also available for use as a blocking control in assays to test for specificity of this C2orf30 antibody

Images

Western Blot analysis using C2orf30 antibody (70R-4009)

C2orf30 antibody (70R-4009) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2orf30 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C2orf30 is a probable lectin that binds selectively to improperly folded lumenal proteins. May function in endoplasmic reticulum quality control and endoplasmic reticulum-associated degradation (ERAD) of both non-glycosylated proteins and glycoproteins.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C2orf30 antibody (70R-4009) | C2orf30 antibody (70R-4009) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors