C2ORF33 antibody (70R-6372)

Rabbit polyclonal C2ORF33 antibody raised against the C terminal Of C2Orf33

Synonyms Polyclonal C2ORF33 antibody, Anti-C2ORF33 antibody, Chromosome ORF 2, Chromosome ORF-2 antibody, DKFZp666J168 antibody, GL004 antibody, Chromosome ORF-2, Chromosome 2 ORF, MGC110913 antibody, Chromosome ORF 2 antibody
Specificity C2ORF33 antibody was raised against the C terminal Of C2Orf33
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C2ORF33 antibody was raised using the C terminal Of C2Orf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW
Assay Information C2ORF33 Blocking Peptide, catalog no. 33R-9870, is also available for use as a blocking control in assays to test for specificity of this C2ORF33 antibody

Images

Western Blot analysis using C2ORF33 antibody (70R-6372)

C2ORF33 antibody (70R-6372) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2ORF33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C2orf33 plays a role in mitochondrial and peroxisomal fission.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C2ORF33 antibody (70R-6372) | C2ORF33 antibody (70R-6372) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors