C2ORF42 antibody (70R-3949)

Rabbit polyclonal C2ORF42 antibody raised against the C terminal Of C2Orf42

Synonyms Polyclonal C2ORF42 antibody, Anti-C2ORF42 antibody, Chromosome ORF 2, FLJ20558 antibody, Chromosome ORF-2, Chromosome 2 ORF, Chromosome ORF 2 antibody, Chromosome ORF-2 antibody
Specificity C2ORF42 antibody was raised against the C terminal Of C2Orf42
Cross Reactivity Human,Rat
Applications WB
Immunogen C2ORF42 antibody was raised using the C terminal Of C2Orf42 corresponding to a region with amino acids ITRSFIQNRDGTYELFKCPKVEVESIAETYGRIEKQPVLRPLELKTFLKV
Assay Information C2ORF42 Blocking Peptide, catalog no. 33R-4188, is also available for use as a blocking control in assays to test for specificity of this C2ORF42 antibody

Images

Western Blot analysis using C2ORF42 antibody (70R-3949)

C2ORF42 antibody (70R-3949) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2ORF42 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C2orf42 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C2ORF42 antibody (70R-3949) | C2ORF42 antibody (70R-3949) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors