C2ORF47 antibody (70R-4100)

Rabbit polyclonal C2ORF47 antibody raised against the middle region of C2Orf47

Synonyms Polyclonal C2ORF47 antibody, Anti-C2ORF47 antibody, Chromosome 2 ORF, Chromosome ORF 2 antibody, DKFZp666A212 antibody, Chromosome ORF-2 antibody, Chromosome ORF-2, FLJ22555 antibody, Chromosome ORF 2
Specificity C2ORF47 antibody was raised against the middle region of C2Orf47
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C2ORF47 antibody was raised using the middle region of C2Orf47 corresponding to a region with amino acids GASVFQVKLGNQNVETKQLLSASYEFQREFTQGVKPDWTIARIEHSKLLE
Assay Information C2ORF47 Blocking Peptide, catalog no. 33R-3173, is also available for use as a blocking control in assays to test for specificity of this C2ORF47 antibody

Images

Western Blot analysis using C2ORF47 antibody (70R-4100)

C2ORF47 antibody (70R-4100) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 32 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2ORF47 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the C2orf47 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C2ORF47 antibody (70R-4100) | C2ORF47 antibody (70R-4100) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors