C2ORF55 antibody (70R-4287)

Rabbit polyclonal C2ORF55 antibody raised against the middle region of C2Orf55

Synonyms Polyclonal C2ORF55 antibody, Anti-C2ORF55 antibody, Chromosome ORF 2, Chromosome ORF 2 antibody, Chromosome 2 ORF, Chromosome ORF-2, Chromosome ORF-2 antibody, MGC42367 antibody
Specificity C2ORF55 antibody was raised against the middle region of C2Orf55
Cross Reactivity Human
Applications WB
Immunogen C2ORF55 antibody was raised using the middle region of C2Orf55 corresponding to a region with amino acids ITVTRQKRRGTLDQPPNQEDKPGARTLKSEPGKQAKVPERGQEPVKQADF
Assay Information C2ORF55 Blocking Peptide, catalog no. 33R-4191, is also available for use as a blocking control in assays to test for specificity of this C2ORF55 antibody


Western Blot analysis using C2ORF55 antibody (70R-4287)

C2ORF55 antibody (70R-4287) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 102 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2ORF55 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C2ORF55 antibody (70R-4287) | C2ORF55 antibody (70R-4287) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors