C2ORF62 antibody (70R-4275)

Rabbit polyclonal C2ORF62 antibody raised against the N terminal Of C2Orf62

Synonyms Polyclonal C2ORF62 antibody, Anti-C2ORF62 antibody, Chromosome ORF-2, Chromosome ORF-2 antibody, Chromosome ORF 2 antibody, Chromosome 2 ORF, Chromosome ORF 2, MGC50811 antibody
Specificity C2ORF62 antibody was raised against the N terminal Of C2Orf62
Cross Reactivity Human
Applications WB
Immunogen C2ORF62 antibody was raised using the N terminal Of C2Orf62 corresponding to a region with amino acids MSSKVYSTGSRAKDHQPSGPECLPLPEANAEAIDFLSSLHKEELQMLFFS
Assay Information C2ORF62 Blocking Peptide, catalog no. 33R-6499, is also available for use as a blocking control in assays to test for specificity of this C2ORF62 antibody


Western Blot analysis using C2ORF62 antibody (70R-4275)

C2ORF62 antibody (70R-4275) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C2ORF62 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 2 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C2ORF62 antibody (70R-4275) | C2ORF62 antibody (70R-4275) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors