C3orf33 antibody (70R-4032)

Rabbit polyclonal C3orf33 antibody raised against the middle region of C3orf33

Synonyms Polyclonal C3orf33 antibody, Anti-C3orf33 antibody, Chromosome ORF-3, Chromosome 3 Open Reading Frame 33 antibody, Chromosome ORF 3, Chromosome ORF 3 antibody, Chromosome ORF-3 antibody, FLJ31139 antibody, Chromosome 3 ORF
Specificity C3orf33 antibody was raised against the middle region of C3orf33
Cross Reactivity Human
Applications WB
Immunogen C3orf33 antibody was raised using the middle region of C3orf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR
Assay Information C3orf33 Blocking Peptide, catalog no. 33R-6869, is also available for use as a blocking control in assays to test for specificity of this C3orf33 antibody

Images

Western Blot analysis using C3orf33 antibody (70R-4032)

C3orf33 antibody (70R-4032) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 29 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C3orf33 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 3 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C3orf33 antibody (70R-4032) | C3orf33 antibody (70R-4032) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors