C3ORF64 antibody (70R-5375)

Rabbit polyclonal C3ORF64 antibody raised against the C terminal Of C3Orf64

Synonyms Polyclonal C3ORF64 antibody, Anti-C3ORF64 antibody, AER61 antibody, FLJ13078 antibody, FLJ33770 antibody, Chromosome ORF-3 antibody, Chromosome ORF-3, FLJ41219 antibody, Chromosome ORF 3 antibody, MGC34132 antibody, Chromosome ORF 3, Chromosome 3 ORF
Specificity C3ORF64 antibody was raised against the C terminal Of C3Orf64
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen C3ORF64 antibody was raised using the C terminal Of C3Orf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL
Assay Information C3ORF64 Blocking Peptide, catalog no. 33R-3308, is also available for use as a blocking control in assays to test for specificity of this C3ORF64 antibody


Western Blot analysis using C3ORF64 antibody (70R-5375)

C3ORF64 antibody (70R-5375) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 52 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C3ORF64 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C3orf64 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C3ORF64 antibody (70R-5375) | C3ORF64 antibody (70R-5375) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors