C4BPA antibody (70R-5739)

Rabbit polyclonal C4BPA antibody raised against the middle region of C4BPA

Synonyms Polyclonal C4BPA antibody, Anti-C4BPA antibody, C4BP, CBP 4, C4BP antibody, PRP antibody, CBP 4 antibody, CBP-4, CBP-4 antibody, Complement 4 Binding Protein Alpha antibody
Specificity C4BPA antibody was raised against the middle region of C4BPA
Cross Reactivity Human
Applications WB
Immunogen C4BPA antibody was raised using the middle region of C4BPA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Assay Information C4BPA Blocking Peptide, catalog no. 33R-7781, is also available for use as a blocking control in assays to test for specificity of this C4BPA antibody

Images

Western Blot analysis using C4BPA antibody (70R-5739)

C4BPA antibody (70R-5739) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4BPA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C4BPA antibody (70R-5739) | C4BPA antibody (70R-5739) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors