C4ORF20 antibody (70R-4373)

Rabbit polyclonal C4ORF20 antibody raised against the middle region of C4Orf20

Synonyms Polyclonal C4ORF20 antibody, Anti-C4ORF20 antibody, UFSP2 antibody, Chromosome ORF-4 antibody, Chromosome 4 ORF, FLJ11200 antibody, Chromosome ORF-4, Chromosome ORF 4, Chromosome ORF 4 antibody
Specificity C4ORF20 antibody was raised against the middle region of C4Orf20
Cross Reactivity Human
Applications WB
Immunogen C4ORF20 antibody was raised using the middle region of C4Orf20 corresponding to a region with amino acids YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD
Assay Information C4ORF20 Blocking Peptide, catalog no. 33R-10125, is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody

Images

Western Blot analysis using C4ORF20 antibody (70R-4373)

C4ORF20 antibody (70R-4373) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C4ORF20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ubiquitin-fold modifier-1 must be processed by a protease before it can conjugate with its target proteins. C4ORF20 is a thiol protease that specifically processes the C terminus of UFM1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C4ORF20 antibody (70R-4373) | C4ORF20 antibody (70R-4373) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors