C5ORF36 antibody (70R-4264)

Rabbit polyclonal C5ORF36 antibody raised against the N terminal Of C5Orf36

Synonyms Polyclonal C5ORF36 antibody, Anti-C5ORF36 antibody, Chromosome ORF 5, Chromosome ORF-5 antibody, MGC34713 antibody, Chromosome 5 ORF, Chromosome ORF 5 antibody, DKFZp686F0372 antibody, Chromosome ORF-5
Specificity C5ORF36 antibody was raised against the N terminal Of C5Orf36
Cross Reactivity Human
Applications WB
Immunogen C5ORF36 antibody was raised using the N terminal Of C5Orf36 corresponding to a region with amino acids CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD
Assay Information C5ORF36 Blocking Peptide, catalog no. 33R-1681, is also available for use as a blocking control in assays to test for specificity of this C5ORF36 antibody

Images

Western Blot analysis using C5ORF36 antibody (70R-4264)

C5ORF36 antibody (70R-4264) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C5ORF36 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C5orf36 is not yet known.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C5ORF36 antibody (70R-4264) | C5ORF36 antibody (70R-4264) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors