C5ORF39 antibody (70R-2188)

Rabbit polyclonal C5ORF39 antibody raised against the N terminal Of C5Orf39

Synonyms Polyclonal C5ORF39 antibody, Anti-C5ORF39 antibody, AXIIR antibody, Chromosome ORF 5 antibody, Chromosome ORF 5, Chromosome 5 ORF, AX2R antibody, Chromosome ORF-5, Chromosome ORF-5 antibody
Specificity C5ORF39 antibody was raised against the N terminal Of C5Orf39
Cross Reactivity Human
Applications WB
Immunogen C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS
Assay Information C5ORF39 Blocking Peptide, catalog no. 33R-2665, is also available for use as a blocking control in assays to test for specificity of this C5ORF39 antibody

Images

Western Blot analysis using C5ORF39 antibody (70R-2188)

C5ORF39 antibody (70R-2188) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C5ORF39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C5orf39 may act as a receptor for annexin II on marrow stromal cells to induce osteoclast formation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C5ORF39 antibody (70R-2188) | C5ORF39 antibody (70R-2188) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors