C5ORF4 antibody (70R-7070)

Rabbit polyclonal C5ORF4 antibody raised against the N terminal Of C5Orf4

Synonyms Polyclonal C5ORF4 antibody, Anti-C5ORF4 antibody, Chromosome ORF 5, Chromosome ORF-5 antibody, Chromosome ORF-5, FLJ13758 antibody, Chromosome ORF 5 antibody, Chromosome 5 ORF
Specificity C5ORF4 antibody was raised against the N terminal Of C5Orf4
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen C5ORF4 antibody was raised using the N terminal Of C5Orf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ
Assay Information C5ORF4 Blocking Peptide, catalog no. 33R-6138, is also available for use as a blocking control in assays to test for specificity of this C5ORF4 antibody

Images

Immunohistochemical staining using C5ORF4 antibody (70R-7070)

C5ORF4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C5ORF4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C5ORF4 is involved in the fatty acid biosynthetic process.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using C5ORF4 antibody (70R-7070) | C5ORF4 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using C5ORF4 antibody (70R-7070) | C5ORF4 antibody (70R-7070) used at 0.25 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors