C6ORF134 antibody (70R-3866)

Rabbit polyclonal C6ORF134 antibody raised against the middle region of C6Orf134

Synonyms Polyclonal C6ORF134 antibody, Anti-C6ORF134 antibody, Chromosome ORF-6, Chromosome ORF 6, DKFZp547J097 antibody, FLJ13158 antibody, Chromosome ORF-6 antibody, Chromosome ORF 6 antibody, Chromosome 6 ORF, Nbla00487 antibody
Specificity C6ORF134 antibody was raised against the middle region of C6Orf134
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C6ORF134 antibody was raised using the middle region of C6Orf134 corresponding to a region with amino acids DDREAHNEVEPLCILDFYIHESVQRHGHGRELFQYMLQKERVEPHQLAID
Assay Information C6ORF134 Blocking Peptide, catalog no. 33R-1888, is also available for use as a blocking control in assays to test for specificity of this C6ORF134 antibody

Images

Western Blot analysis using C6ORF134 antibody (70R-3866)

C6ORF134 antibody (70R-3866) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C6ORF134 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C6orf134 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C6ORF134 antibody (70R-3866) | C6ORF134 antibody (70R-3866) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors