C6orf154 antibody (70R-4433)

Rabbit polyclonal C6orf154 antibody raised against the N terminal of C6orf154

Synonyms Polyclonal C6orf154 antibody, Anti-C6orf154 antibody, MGC131686 antibody, Chromosome 6 Open Reading Frame 154 antibody, FLJ44836 antibody, Chromosome ORF 6 antibody, Chromosome ORF 6, Chromosome 6 ORF, dJ337H4.2 antibody, Chromosome ORF-6 antibody, Chromosome ORF-6
Specificity C6orf154 antibody was raised against the N terminal of C6orf154
Cross Reactivity Human
Applications WB
Immunogen C6orf154 antibody was raised using the N terminal of C6orf154 corresponding to a region with amino acids MLPSSIQISGEPLSGAEVRDICRGLRDNAVRLLSLRGCRLCDRDFGRICR
Assay Information C6orf154 Blocking Peptide, catalog no. 33R-6203, is also available for use as a blocking control in assays to test for specificity of this C6orf154 antibody


Western Blot analysis using C6orf154 antibody (70R-4433)

C6orf154 antibody (70R-4433) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C6orf154 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C6orf154 antibody (70R-4433) | C6orf154 antibody (70R-4433) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors