C6ORF154 antibody (70R-4442)

Rabbit polyclonal C6ORF154 antibody raised against the middle region of C6Orf154

Synonyms Polyclonal C6ORF154 antibody, Anti-C6ORF154 antibody, MGC131686 antibody, Chromosome ORF-6, dJ337H4.2 antibody, Chromosome 6 ORF, Chromosome ORF 6, Chromosome ORF 6 antibody, Chromosome ORF-6 antibody, FLJ44836 antibody
Specificity C6ORF154 antibody was raised against the middle region of C6Orf154
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C6ORF154 antibody was raised using the middle region of C6Orf154 corresponding to a region with amino acids NLDYNPLGDHVAGMLAVAVASSRTLEVLDLEGTGLTNQSAQTLLDMVENY
Assay Information C6ORF154 Blocking Peptide, catalog no. 33R-6754, is also available for use as a blocking control in assays to test for specificity of this C6ORF154 antibody

Images

Western Blot analysis using C6ORF154 antibody (70R-4442)

C6ORF154 antibody (70R-4442) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C6ORF154 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 6 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C6ORF154 antibody (70R-4442) | C6ORF154 antibody (70R-4442) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors