C6ORF173 antibody (70R-4208)

Rabbit polyclonal C6ORF173 antibody raised against the N terminal Of C6Orf173

Synonyms Polyclonal C6ORF173 antibody, Anti-C6ORF173 antibody, Chromosome ORF 6, CUG2 antibody, Chromosome ORF 6 antibody, Chromosome 6 ORF, Chromosome ORF-6 antibody, DKFZp686L1553 antibody, Chromosome ORF-6
Specificity C6ORF173 antibody was raised against the N terminal Of C6Orf173
Cross Reactivity Human
Applications WB
Immunogen C6ORF173 antibody was raised using the N terminal Of C6Orf173 corresponding to a region with amino acids ALSTIVSQRKQIKRKAPRGFLKRVFKRKKPQLRLEKSGDLLVHLNCLLFV
Assay Information C6ORF173 Blocking Peptide, catalog no. 33R-1372, is also available for use as a blocking control in assays to test for specificity of this C6ORF173 antibody

Images

Western Blot analysis using C6ORF173 antibody (70R-4208)

C6ORF173 antibody (70R-4208) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 10 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C6ORF173 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance C6orf173 is up-regulated in many cancer tissues. It suggests that C6orf173 may act as an oncogene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C6ORF173 antibody (70R-4208) | C6ORF173 antibody (70R-4208) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors