C6ORF199 antibody (70R-4250)

Rabbit polyclonal C6ORF199 antibody raised against the N terminal Of C6Orf199

Synonyms Polyclonal C6ORF199 antibody, Anti-C6ORF199 antibody, Chromosome ORF-6 antibody, FLJ42177 antibody, Chromosome 6 ORF, Chromosome ORF 6 antibody, dJ70A9.1 antibody, Chromosome ORF 6, RP1-70A9.1 antibody, MGC26954 antibody, Chromosome ORF-6
Specificity C6ORF199 antibody was raised against the N terminal Of C6Orf199
Cross Reactivity Human
Applications WB
Immunogen C6ORF199 antibody was raised using the N terminal Of C6Orf199 corresponding to a region with amino acids TSQEKTEEYPFADIFDEDETERNFLLSKPVCFVVFGKPGVGKTTLARYIT
Assay Information C6ORF199 Blocking Peptide, catalog no. 33R-9292, is also available for use as a blocking control in assays to test for specificity of this C6ORF199 antibody


Western Blot analysis using C6ORF199 antibody (70R-4250)

C6ORF199 antibody (70R-4250) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C6ORF199 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the C6orf199 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C6ORF199 antibody (70R-4250) | C6ORF199 antibody (70R-4250) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors