C6ORF21 antibody (70R-6411)

Rabbit polyclonal C6ORF21 antibody raised against the middle region of C6Orf21

Synonyms Polyclonal C6ORF21 antibody, Anti-C6ORF21 antibody, Chromosome ORF-6, LY6G6D antibody, Chromosome 6 ORF, G6f antibody, NG32 antibody, Chromosome ORF 6 antibody, Chromosome ORF 6, Chromosome ORF-6 antibody
Specificity C6ORF21 antibody was raised against the middle region of C6Orf21
Cross Reactivity Human
Applications WB
Immunogen C6ORF21 antibody was raised using the middle region of C6Orf21 corresponding to a region with amino acids LLCSVVPSRRMDSVTWQEGKGPVRGRVQSFWGSEAALLLVCPGEGLSEPR
Assay Information C6ORF21 Blocking Peptide, catalog no. 33R-5121, is also available for use as a blocking control in assays to test for specificity of this C6ORF21 antibody

Images

Western Blot analysis using C6ORF21 antibody (70R-6411)

C6ORF21 antibody (70R-6411) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C6ORF21 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The human G6f protein(C6orf21) is a type I transmembrane protein belonging to the immunoglobin (Ig) superfamily, which is comprised of cell-surface proteins involved in the immune system and cellular recognition.It may also play a role in the downstream signal transduction pathways involving GRB2 and GRB7.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C6ORF21 antibody (70R-6411) | C6ORF21 antibody (70R-6411) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors