C6ORF25 antibody (70R-7232)

Rabbit polyclonal C6ORF25 antibody raised against the N terminal Of C6Orf25

Synonyms Polyclonal C6ORF25 antibody, Anti-C6ORF25 antibody, MGC142281 antibody, Chromosome ORF 6 antibody, Chromosome ORF-6, NG31 antibody, Chromosome ORF 6, Chromosome 6 ORF, Chromosome ORF-6 antibody, MGC142279 antibody, G6b antibody
Specificity C6ORF25 antibody was raised against the N terminal Of C6Orf25
Cross Reactivity Human
Applications WB
Immunogen C6ORF25 antibody was raised using the N terminal Of C6Orf25 corresponding to a region with amino acids AVFLQLLPLLLSRAQGNPGASLDGRPGDRVNLSCGGVSHPIRWVWAPSFP
Assay Information C6ORF25 Blocking Peptide, catalog no. 33R-1591, is also available for use as a blocking control in assays to test for specificity of this C6ORF25 antibody

Images

Western Blot analysis using C6ORF25 antibody (70R-7232)

C6ORF25 antibody (70R-7232) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C6ORF25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene is a member of the immunoglobulin (Ig) superfamily and is located in the major histocompatibility complex (MHC) class III region. The protein encoded by this gene is a glycosylated, plasma membrane-bound cell surface receptor, but soluble isoforms encoded by some transcript variants have been found in the endoplasmic reticulum and Golgi before being secreted. Multiple transcript variants encoding different isoforms have been found for this gene.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C6ORF25 antibody (70R-7232) | C6ORF25 antibody (70R-7232) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors