C7ORF31 antibody (70R-3267)

Rabbit polyclonal C7ORF31 antibody raised against the N terminal Of C7Orf31

Synonyms Polyclonal C7ORF31 antibody, Anti-C7ORF31 antibody, Chromosome ORF 7 antibody, Chromosome ORF 7, Chromosome ORF-7 antibody, , Chromosome ORF-7, Chromosome 7 ORF
Specificity C7ORF31 antibody was raised against the N terminal Of C7Orf31
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C7ORF31 antibody was raised using the N terminal Of C7Orf31 corresponding to a region with amino acids EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRE
Assay Information C7ORF31 Blocking Peptide, catalog no. 33R-2789, is also available for use as a blocking control in assays to test for specificity of this C7ORF31 antibody


Western Blot analysis using C7ORF31 antibody (70R-3267)

C7ORF31 antibody (70R-3267) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C7ORF31 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C7orf31 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C7ORF31 antibody (70R-3267) | C7ORF31 antibody (70R-3267) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors