C7ORF43 antibody (70R-3224)

Rabbit polyclonal C7ORF43 antibody raised against the middle region of C7Orf43

Synonyms Polyclonal C7ORF43 antibody, Anti-C7ORF43 antibody, Chromosome ORF-7 antibody, Chromosome ORF 7, Chromosome 7 ORF, Chromosome ORF 7 antibody, FLJ10925 antibody, DKFZp761G0712 antibody, Chromosome ORF-7
Specificity C7ORF43 antibody was raised against the middle region of C7Orf43
Cross Reactivity Human
Applications WB
Immunogen C7ORF43 antibody was raised using the middle region of C7Orf43 corresponding to a region with amino acids DLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPL
Assay Information C7ORF43 Blocking Peptide, catalog no. 33R-2071, is also available for use as a blocking control in assays to test for specificity of this C7ORF43 antibody

Images

Western Blot analysis using C7ORF43 antibody (70R-3224)

C7ORF43 antibody (70R-3224) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 62 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C7ORF43 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 7 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C7ORF43 antibody (70R-3224) | C7ORF43 antibody (70R-3224) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors