C8ORF34 antibody (70R-4132)

Rabbit polyclonal C8ORF34 antibody raised against the N terminal Of C8Orf34

Synonyms Polyclonal C8ORF34 antibody, Anti-C8ORF34 antibody, Chromosome 8 ORF, Chromosome ORF 8, vest-1 antibody, DKFZp547E186 antibody, FLJ36872 antibody, Chromosome ORF-8, VEST1 antibody, Chromosome ORF-8 antibody, Chromosome ORF 8 antibody
Specificity C8ORF34 antibody was raised against the N terminal Of C8Orf34
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C8ORF34 antibody was raised using the N terminal Of C8Orf34 corresponding to a region with amino acids MTKLITETPDQPIPFLIDHLQSKQGNRGQLQRTLSGSAALWAESEKSESK
Assay Information C8ORF34 Blocking Peptide, catalog no. 33R-6548, is also available for use as a blocking control in assays to test for specificity of this C8ORF34 antibody


Western Blot analysis using C8ORF34 antibody (70R-4132)

C8ORF34 antibody (70R-4132) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C8ORF34 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C8orf34 protein has not been widely studied, and is yet to be fully elucidated.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C8ORF34 antibody (70R-4132) | C8ORF34 antibody (70R-4132) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors