C8orf45 antibody (70R-4564)

Rabbit polyclonal C8orf45 antibody raised against the middle region of C8orf45

Synonyms Polyclonal C8orf45 antibody, Anti-C8orf45 antibody, Chromosome ORF 8, Chromosome ORF-8, FLJ25692 antibody, Chromosome 8 ORF, Chromosome ORF-8 antibody, Chromosome ORF 8 antibody, Chromosome 8 Open Reading Frame 45 antibody
Specificity C8orf45 antibody was raised against the middle region of C8orf45
Cross Reactivity Human
Applications WB
Immunogen C8orf45 antibody was raised using the middle region of C8orf45 corresponding to a region with amino acids IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE
Assay Information C8orf45 Blocking Peptide, catalog no. 33R-4107, is also available for use as a blocking control in assays to test for specificity of this C8orf45 antibody

Images

Western Blot analysis using C8orf45 antibody (70R-4564)

C8orf45 antibody (70R-4564) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 65 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C8orf45 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of Chromosome 8 ORF protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C8orf45 antibody (70R-4564) | C8orf45 antibody (70R-4564) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors