C9ORF25 antibody (70R-3891)

Rabbit polyclonal C9ORF25 antibody raised against the middle region of C9Orf25

Synonyms Polyclonal C9ORF25 antibody, Anti-C9ORF25 antibody, Chromosome ORF 9, Chromosome ORF 9 antibody, Chromosome 9 ORF, Chromosome ORF-9, FLJ39031 antibody, Chromosome ORF-9 antibody, bA573M23.5 antibody
Specificity C9ORF25 antibody was raised against the middle region of C9Orf25
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C9ORF25 antibody was raised using the middle region of C9Orf25 corresponding to a region with amino acids SSSGYSSAEQINQDLNIQLLKDGYRLDEIPDDEDLDLIPPKSVNPTCMCC
Assay Information C9ORF25 Blocking Peptide, catalog no. 33R-8849, is also available for use as a blocking control in assays to test for specificity of this C9ORF25 antibody

Images

Western Blot analysis using C9ORF25 antibody (70R-3891)

C9ORF25 antibody (70R-3891) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C9ORF25 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene has homologs that have been identified in mouse and macaque. The mouse and human proteins have a putative prenyl group binding site (CAAX box) at their C-terminus. A diverse list of proteins are known or strongly presumed to be the target of post-translational modification by the attachment of either a farnesyl or a geranyl-geranyl group to a cysteine residue at the C-terminus.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C9ORF25 antibody (70R-3891) | C9ORF25 antibody (70R-3891) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors