C9ORF46 antibody (70R-6362)

Rabbit polyclonal C9ORF46 antibody raised against the middle region of C9Orf46

Synonyms Polyclonal C9ORF46 antibody, Anti-C9ORF46 antibody, AD025 antibody, FLJ39176 antibody, MDS030 antibody, Chromosome ORF 9 antibody, FLJ14688 antibody, Chromosome 9 ORF, Chromosome ORF 9, Chromosome ORF-9, Chromosome ORF-9 antibody
Specificity C9ORF46 antibody was raised against the middle region of C9Orf46
Cross Reactivity Human
Applications WB
Immunogen C9ORF46 antibody was raised using the middle region of C9Orf46 corresponding to a region with amino acids AIKKKKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKL
Assay Information C9ORF46 Blocking Peptide, catalog no. 33R-1270, is also available for use as a blocking control in assays to test for specificity of this C9ORF46 antibody

Images

Western Blot analysis using C9ORF46 antibody (70R-6362)

C9ORF46 antibody (70R-6362) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C9ORF46 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of C9orf46 protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using C9ORF46 antibody (70R-6362) | C9ORF46 antibody (70R-6362) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors