C9ORF75 antibody (70R-3147)

Rabbit polyclonal C9ORF75 antibody raised against the middle region of C9Orf75

Synonyms Polyclonal C9ORF75 antibody, Anti-C9ORF75 antibody, FLJ90254 antibody, RP11-350O14.7 antibody, Chromosome ORF-9 antibody, Chromosome ORF-9, Chromosome 9 ORF, Chromosome ORF 9, Chromosome ORF 9 antibody, MGC131933 antibody
Specificity C9ORF75 antibody was raised against the middle region of C9Orf75
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen C9ORF75 antibody was raised using the middle region of C9Orf75 corresponding to a region with amino acids EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY
Assay Information C9ORF75 Blocking Peptide, catalog no. 33R-2269, is also available for use as a blocking control in assays to test for specificity of this C9ORF75 antibody


Western Blot analysis using C9ORF75 antibody (70R-3147)

C9ORF75 antibody (70R-3147) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of C9ORF75 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The specific function of C9orf75 is not yet known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using C9ORF75 antibody (70R-3147) | C9ORF75 antibody (70R-3147) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors