CAB39 antibody (70R-3696)

Rabbit polyclonal CAB39 antibody raised against the middle region of CAB39

Synonyms Polyclonal CAB39 antibody, Anti-CAB39 antibody, CAB-39 antibody, CAB 39 antibody, CGI-66 antibody, CAB39, FLJ22682 antibody, MO25 antibody, CAB-39, CAB 39, Calcium Binding Protein 39 antibody
Specificity CAB39 antibody was raised against the middle region of CAB39
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen CAB39 antibody was raised using the middle region of CAB39 corresponding to a region with amino acids KTQPILDILLKNQAKLIEFLSKFQNDRTEDEQFNDEKTYLVKQIRDLKRP
Assay Information CAB39 Blocking Peptide, catalog no. 33R-4688, is also available for use as a blocking control in assays to test for specificity of this CAB39 antibody

Images

Western Blot analysis using CAB39 antibody (70R-3696)

CAB39 antibody (70R-3696) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAB39 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Together with the STE20-related adaptor-alpha (STRAD alpha) pseudo kinase, CAB39 forms a regulatory complex capable of stimulating the activity of STK11.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CAB39 antibody (70R-3696) | CAB39 antibody (70R-3696) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors