CACHD1 antibody (70R-6902)

Rabbit polyclonal CACHD1 antibody raised against the N terminal of CACHD1

Synonyms Polyclonal CACHD1 antibody, Anti-CACHD1 antibody, Cache Domain Containing 1 antibody, KIAA1573 antibody, RP4-655E10.1 antibody
Specificity CACHD1 antibody was raised against the N terminal of CACHD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CACHD1 antibody was raised using the N terminal of CACHD1 corresponding to a region with amino acids HKFRCKGSYEHRSRPIYVSTVRPQSKHIVVILDHGASVTDTQLQIAKDAA
Assay Information CACHD1 Blocking Peptide, catalog no. 33R-3761, is also available for use as a blocking control in assays to test for specificity of this CACHD1 antibody

Images

Western Blot analysis using CACHD1 antibody (70R-6902)

CACHD1 antibody (70R-6902) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 137 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACHD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACHD1 belongs to the calcium channel subunit alpha-2/delta family. It contains 2 cache domains and 1 VWFA domain. CACHD1 may regulate voltage-dependent calcium channels.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CACHD1 antibody (70R-6902) | CACHD1 antibody (70R-6902) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors