CACNA1I antibody (70R-5133)

Rabbit polyclonal CACNA1I antibody raised against the middle region of CACNA1I

Synonyms Polyclonal CACNA1I antibody, Anti-CACNA1I antibody, Calcium Channel Voltage-Dependent T Type Alpha 1I Subunit antibody, CACNA 1, CACNA-1, CACNA1, CACNA 1 antibody, CACNA-1 antibody, Cav3.3 antibody, KIAA1120 antibody
Specificity CACNA1I antibody was raised against the middle region of CACNA1I
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CACNA1I antibody was raised using the middle region of CACNA1I corresponding to a region with amino acids LRTDTGDTVPDRKNFDSLLWAIVTVFQILTQEDWNVVLYNGMASTSPWAS
Assay Information CACNA1I Blocking Peptide, catalog no. 33R-5397, is also available for use as a blocking control in assays to test for specificity of this CACNA1I antibody

Images

Western blot analysis using CACNA1I antibody (70R-5133)

Recommended CACNA1I Antibody Titration: 0.2-1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 245 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNA1I antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-dependent calcium channels control the rapid entry of Ca(2+) into a variety of cell types and are therefore involved in both electrical and cellular signaling. T-type channels, such as CACNA1I, are activated by small membrane depolarizations and can generate burst firing and pacemaker activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using CACNA1I antibody (70R-5133) | Recommended CACNA1I Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors