CACNA2D1 antibody (70R-5102)

Rabbit polyclonal CACNA2D1 antibody raised against the middle region of CACNA2D1

Synonyms Polyclonal CACNA2D1 antibody, Anti-CACNA2D1 antibody, CACNA2, Calcium Channel Voltage-Dependent Alpha 2/Delta Subunit 1 antibody, CACNA 2 antibody, CACNA-2 antibody, CACNA-2, CACNA 2
Specificity CACNA2D1 antibody was raised against the middle region of CACNA2D1
Cross Reactivity Human, Mouse, Rat, Dog
Applications WB
Immunogen CACNA2D1 antibody was raised using the middle region of CACNA2D1 corresponding to a region with amino acids PKSQEPVTLDFLDAELENDIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
Assay Information CACNA2D1 Blocking Peptide, catalog no. 33R-7178, is also available for use as a blocking control in assays to test for specificity of this CACNA2D1 antibody


Western Blot analysis using CACNA2D1 antibody (70R-5102)

CACNA2D1 antibody (70R-5102) used at 0.12 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 120 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNA2D1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.12 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNA2D1 encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CACNA2D1 antibody (70R-5102) | CACNA2D1 antibody (70R-5102) used at 0.12 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors