CACNB1 antibody (70R-5072)

Rabbit polyclonal CACNB1 antibody raised against the middle region of CACNB1

Synonyms Polyclonal CACNB1 antibody, Anti-CACNB1 antibody, CACNB-1, MGC41896 antibody, CACNLB1 antibody, CACNB-1 antibody, CCHLB1 antibody, CACNB 1 antibody, CAB1 antibody, CACNB1, CACNB 1, Calcium Channel Voltage-Dependent Beta 1 Subunit antibody
Specificity CACNB1 antibody was raised against the middle region of CACNB1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CACNB1 antibody was raised using the middle region of CACNB1 corresponding to a region with amino acids KVLQRLIKSRGKSQSKHLNVQIAASEKLAQCPPEMFDIILDENQLEDACE
Assay Information CACNB1 Blocking Peptide, catalog no. 33R-4715, is also available for use as a blocking control in assays to test for specificity of this CACNB1 antibody

Images

Western Blot analysis using CACNB1 antibody (70R-5072)

CACNB1 antibody (70R-5072) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNB1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB1 belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CACNB1 antibody (70R-5072) | CACNB1 antibody (70R-5072) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors