CACNB2 antibody (70R-1509)

Rabbit polyclonal CACNB2 antibody raised against the C terminal of CACNB2

Synonyms Polyclonal CACNB2 antibody, Anti-CACNB2 antibody, CACNB-2, CACNB 2, RP11-383B4.2 antibody, Calcium Channel Voltage-Dependent Beta 2 Subunit antibody, CACNB2, FLJ23743 antibody, CACNB-2 antibody, CACNLB2 antibody, CACNB 2 antibody, MYSB antibody
Specificity CACNB2 antibody was raised against the C terminal of CACNB2
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen CACNB2 antibody was raised using the C terminal of CACNB2 corresponding to a region with amino acids APHHNHRSGTSRGLSRQETFDSETQESRDSAYVEPKEDYSHDHVDHYASH
Assay Information CACNB2 Blocking Peptide, catalog no. 33R-1423, is also available for use as a blocking control in assays to test for specificity of this CACNB2 antibody


Western Blot analysis using CACNB2 antibody (70R-1509)

CACNB2 antibody (70R-1509) used at 2.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CACNB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB2 is a member of the ion-channel geneuperfamily. Described as a Lambert-Eaton myasthenic syndrome (LEMS) antigen in humans, this gene is found close to a region that undergoes chromosome rearrangements in small cell lung cancer, which occurs in association with LEMS.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CACNB2 antibody (70R-1509) | CACNB2 antibody (70R-1509) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $315.00
Size: 100 ug
View Our Distributors