CACNB2 antibody (70R-5063)

Rabbit polyclonal CACNB2 antibody raised against the middle region of CACNB2

Synonyms Polyclonal CACNB2 antibody, Anti-CACNB2 antibody, Calcium Channel Voltage-Dependent Beta 2 Subunit antibody, MYSB antibody, CACNB-2, CACNB 2 antibody, CACNB-2 antibody, CACNB2, CACNB 2, CACNLB2 antibody, FLJ23743 antibody
Specificity CACNB2 antibody was raised against the middle region of CACNB2
Cross Reactivity Human
Applications WB
Immunogen CACNB2 antibody was raised using the middle region of CACNB2 corresponding to a region with amino acids DACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQG
Assay Information CACNB2 Blocking Peptide, catalog no. 33R-1843, is also available for use as a blocking control in assays to test for specificity of this CACNB2 antibody


Western Blot analysis using CACNB2 antibody (70R-5063)

CACNB2 antibody (70R-5063) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNB2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB2 belongs to the calcium channel beta subunit family.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CACNB2 antibody (70R-5063) | CACNB2 antibody (70R-5063) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors