CACNB2 Blocking Peptide (33R-1066)

A synthetic peptide for use as a blocking control in assays to test for specificity of CACNB2 antibody, catalog no. 70R-1508

Synonyms CACNB2 control peptide, CACNB2 antibody Blocking Peptide, Anti-CACNB2 Blocking Peptide, Calcium Channel Voltage-Dependent Beta 2 Subunit Blocking Peptide, RP11-383B4.2 Blocking Peptide, CACNLB2 Blocking Peptide, FLJ23743 Blocking Peptide, MYSB Blocking Peptide, CACNB2, CACNB-2, CACNB 2, CACNB-2 Blocking Peptide, CACNB 2 Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues ACEHLADYLEAYWKATHPPSSSLPNPLLSRTLATSSLPLSPTLASNSQGS
Molecular Weight 67 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB2 is a subunit of voltage-dependent calcium (Ca2+) channels, expressed in the CNS. It appears to serve an obligatory function.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors