CACNB4 antibody (70R-5045)

Rabbit polyclonal CACNB4 antibody raised against the C terminal of CACNB4

Synonyms Polyclonal CACNB4 antibody, Anti-CACNB4 antibody, CACNB4, CACNB 4 antibody, EJM antibody, EA5 antibody, CAB4 antibody, CACNB 4, CACNB-4, Calcium Channel Voltage-Dependent Beta 4 Subunit antibody, CACNLB4 antibody, CACNB-4 antibody
Specificity CACNB4 antibody was raised against the C terminal of CACNB4
Cross Reactivity Human
Applications WB
Immunogen CACNB4 antibody was raised using the C terminal of CACNB4 corresponding to a region with amino acids LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS
Assay Information CACNB4 Blocking Peptide, catalog no. 33R-4882, is also available for use as a blocking control in assays to test for specificity of this CACNB4 antibody

Images

Western Blot analysis using CACNB4 antibody (70R-5045)

CACNB4 antibody (70R-5045) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNB4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNB4 is a member of the beta subunit family, a protein in the voltage-dependent calcium channel complex. CACNB4 plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and inactivation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CACNB4 antibody (70R-5045) | CACNB4 antibody (70R-5045) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors