CACNG6 antibody (70R-5162)

Rabbit polyclonal CACNG6 antibody raised against the N terminal of CACNG6

Synonyms Polyclonal CACNG6 antibody, Anti-CACNG6 antibody, CACNG 6 antibody, CACNG6, CACNG-6 antibody, CACNG 6, Calcium Channel Voltage-Dependent Gamma Subunit 6 antibody, CACNG-6
Specificity CACNG6 antibody was raised against the N terminal of CACNG6
Cross Reactivity Human
Applications WB
Immunogen CACNG6 antibody was raised using the N terminal of CACNG6 corresponding to a region with amino acids MMWSNFFLQEENRRRGAAGRRRAHGQGRSGLTPEREGKVKLALLLAAVGA
Assay Information CACNG6 Blocking Peptide, catalog no. 33R-6240, is also available for use as a blocking control in assays to test for specificity of this CACNG6 antibody

Images

Western Blot analysis using CACNG6 antibody (70R-5162)

CACNG6 antibody (70R-5162) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CACNG6 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CACNG6 is thought to stabilize the calcium channel in an inactivated (closed) state.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CACNG6 antibody (70R-5162) | CACNG6 antibody (70R-5162) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors