CALCRL antibody (70R-6003)

Rabbit polyclonal Calcitonin Receptor-Like antibody raised against the N terminal of CALCRL

Synonyms Polyclonal CALCRL antibody, Anti-CALCRL antibody, CRLR antibody, Calcitonin Receptor-Like antibody, CGRPR antibody
Specificity CALCRL antibody was raised against the N terminal of CALCRL
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen CALCRL antibody was raised using the N terminal of CALCRL corresponding to a region with amino acids DGNWFRHPASNRTWTNYTQCNVNTHEKVKTALNLFYLTIIGHGLSIASLL
Assay Information CALCRL Blocking Peptide, catalog no. 33R-1962, is also available for use as a blocking control in assays to test for specificity of this CALCRL antibody

Images

Western Blot analysis using CALCRL antibody (70R-6003)

CALCRL antibody (70R-6003) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CALCRL antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CALCRL is the receptor for calcitonin-gene-related peptide (CGRP) together with RAMP1 and receptor for adrenomedullin together with RAMP2 or RAMP3. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CALCRL antibody (70R-6003) | CALCRL antibody (70R-6003) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
OR
Shipping
View Our Distributors