Calmegin antibody (70R-1894)

Rabbit polyclonal Calmegin antibody raised against the N terminal of CLGN

Synonyms Polyclonal Calmegin antibody, Anti-Calmegin antibody, CLGN antibody
Specificity Calmegin antibody was raised against the N terminal of CLGN
Cross Reactivity Human
Applications WB
Immunogen Calmegin antibody was raised using the N terminal of CLGN corresponding to a region with amino acids YKTPQPIGEVYFAETFDSGRLAGWVLSKAKKDDMDEEISIYDGRWEIEEL
Assay Information Calmegin Blocking Peptide, catalog no. 33R-10157, is also available for use as a blocking control in assays to test for specificity of this Calmegin antibody

Images

Western Blot analysis using Calmegin antibody (70R-1894)

Calmegin antibody (70R-1894) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of CLGN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Calmegin is a testis-specific endoplasmic reticulum chaperone protein. CLGN may play a role in spermatogeneis and infertility.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Calmegin antibody (70R-1894) | Calmegin antibody (70R-1894) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
OR
Shipping
View Our Distributors