Calmin antibody (70R-7042)

Rabbit polyclonal Calmin antibody

Synonyms Polyclonal Calmin antibody, Anti-Calmin antibody, KIAA1188 antibody, CLMN antibody, FLJ12383 antibody
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Calmin antibody was raised using a synthetic peptide corresponding to a region with amino acids SPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRK
Assay Information Calmin Blocking Peptide, catalog no. 33R-8697, is also available for use as a blocking control in assays to test for specificity of this Calmin antibody


Western Blot analysis using Calmin antibody (70R-7042)

Calmin antibody (70R-7042) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLMN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using Calmin antibody (70R-7042) | Calmin antibody (70R-7042) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors