Calponin 1 antibody (70R-3520)

Rabbit polyclonal Calponin 1 antibody raised against the N terminal of CNN1

Synonyms Polyclonal Calponin 1 antibody, Anti-Calponin 1 antibody, Sm-Calp antibody, Calponin 1 Basic Smooth Muscle antibody, CNN1 antibody, SMCC antibody
Specificity Calponin 1 antibody was raised against the N terminal of CNN1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Calponin 1 antibody was raised using the N terminal of CNN1 corresponding to a region with amino acids MSSAHFNRGPAYGLSAEVKNKLAQKYDHQREQELREWIEGVTGRRIGNNF
Assay Information Calponin 1 Blocking Peptide, catalog no. 33R-6495, is also available for use as a blocking control in assays to test for specificity of this Calponin 1 antibody

Images

Western Blot analysis using Calponin 1 antibody (70R-3520)

Calponin 1 antibody (70R-3520) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CNN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CNN1 is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin Mg-ATPase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Calponin 1 antibody (70R-3520) | Calponin 1 antibody (70R-3520) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors