Calsyntenin 1 antibody (70R-6778)

Rabbit polyclonal Calsyntenin 1 antibody raised against the N terminal of CLSTN1

Synonyms Polyclonal Calsyntenin 1 antibody, Anti-Calsyntenin 1 antibody, alcalpha1 antibody, CSTN1 antibody, CLSTN1 antibody, KIAA0911 antibody, PIK3CD antibody, XB31alpha antibody, FLJ32258 antibody, alcalpha2 antibody
Specificity Calsyntenin 1 antibody was raised against the N terminal of CLSTN1
Cross Reactivity Human
Applications WB
Immunogen Calsyntenin 1 antibody was raised using the N terminal of CLSTN1 corresponding to a region with amino acids KPWLEPTYHGIVTENDNTVLLDPPLIALDKDAPLRFAESFEVTVTKEGEI
Assay Information Calsyntenin 1 Blocking Peptide, catalog no. 33R-4599, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 1 antibody

Images

Western Blot analysis using Calsyntenin 1 antibody (70R-6778)

Calsyntenin 1 antibody (70R-6778) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 110 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLSTN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLSTN1 induces KLC1 association with vesicles and functions as a cargo in axonal anterograde transport. Complex formation with APBA2 and APP, CLSTN1 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Calsyntenin 1 antibody (70R-6778) | Calsyntenin 1 antibody (70R-6778) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors