Calsyntenin 3 antibody (70R-6618)

Rabbit polyclonal Calsyntenin 3 antibody raised against the N terminal of CLSTN3

Synonyms Polyclonal Calsyntenin 3 antibody, Anti-Calsyntenin 3 antibody, CLSTN3 antibody, KIAA0726 antibody, MGC131797 antibody, alcbeta antibody, MGC138488 antibody, CSTN3 antibody
Specificity Calsyntenin 3 antibody was raised against the N terminal of CLSTN3
Cross Reactivity Human
Applications WB
Immunogen Calsyntenin 3 antibody was raised using the N terminal of CLSTN3 corresponding to a region with amino acids QICYYEILTPNTPFLIDNDGNIENTEKLQYSGERLYKFTVTAYDCGKKRA
Assay Information Calsyntenin 3 Blocking Peptide, catalog no. 33R-7585, is also available for use as a blocking control in assays to test for specificity of this Calsyntenin 3 antibody

Images

Western Blot analysis using Calsyntenin 3 antibody (70R-6618)

Calsyntenin 3 antibody (70R-6618) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 106 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CLSTN3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CLSTN3 may modulate calcium-mediated postsynaptic signals. Complex formation with APBA2 and APP,CLSTN3 stabilizes APP metabolism and enhances APBA2-mediated suppression of beta-APP40 secretion, due to the retardation of intracellular APP maturation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Calsyntenin 3 antibody (70R-6618) | Calsyntenin 3 antibody (70R-6618) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors