CAMK1G antibody (70R-4088)

Rabbit polyclonal CAMK1G antibody raised against the N terminal of CAMK1G

Synonyms Polyclonal CAMK1G antibody, Anti-CAMK1G antibody, dJ272L16.1 antibody, Calcium/Calmodulin-Dependent Protein Kinase Ig antibody, CAMK1G antibody, CLICKIII antibody, VWS1 antibody
Specificity CAMK1G antibody was raised against the N terminal of CAMK1G
Cross Reactivity Human
Applications WB
Immunogen CAMK1G antibody was raised using the N terminal of CAMK1G corresponding to a region with amino acids SEVFLVKQRLTGKLFALKCIKKSPAFRDSSLENEIAVLKKIKHENIVTLE
Assay Information CAMK1G Blocking Peptide, catalog no. 33R-8410, is also available for use as a blocking control in assays to test for specificity of this CAMK1G antibody


Western Blot analysis using CAMK1G antibody (70R-4088)

CAMK1G antibody (70R-4088) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 53 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAMK1G antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein similar to calcium/calmodulin dependent protein kinase, however, its exact function is not known.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using CAMK1G antibody (70R-4088) | CAMK1G antibody (70R-4088) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
View Our Distributors