CAMKII antibody (70R-5776)

Rabbit polyclonal CAMKII antibody raised against the N terminal of CAMKK2

Synonyms Polyclonal CAMKII antibody, Anti-CAMKII antibody, CAMKK2 antibody, CAMKK antibody, CAMKKB antibody, Calcium/Calmodulin-Dependent Protein Kinase Kinase 2 Beta antibody, MGC15254 antibody, KIAA0787 antibody
Specificity CAMKII antibody was raised against the N terminal of CAMKK2
Cross Reactivity Human
Applications WB
Immunogen CAMKII antibody was raised using the N terminal of CAMKK2 corresponding to a region with amino acids GGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRLPRRPTVESHHVSITGM
Assay Information CAMKII Blocking Peptide, catalog no. 33R-3291, is also available for use as a blocking control in assays to test for specificity of this CAMKII antibody

Images

Western Blot analysis using CAMKII antibody (70R-5776)

CAMKII antibody (70R-5776) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 55 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of CAMKK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance CAMKK2 is a calcium/calmodulin-dependent protein kinase belonging to a proposed calcium-triggered signaling cascade involved in a number of cellular processes. Isoform 1, isoform 2 and isoform 3 phosphorylate CAMK1 and CAMK4. Isoform 3 phosphorylates CAMK1D. Isoform 4, isoform 5 and isoform 6 lacking part of the calmodulin-binding domain are inactive. CAMKK2 seems to be involved in hippocampal activation of CREB1.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using CAMKII antibody (70R-5776) | CAMKII antibody (70R-5776) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors